PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0065s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 359aa    MW: 40028 Da    PI: 6.7518
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0065s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like66.64.4e-21131185156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k r++Wt eL +rF+ea + L G++ AtP +ilelm+ + Lt+ h++SHLQkYR++
  Kalax.0065s0080.1.p 131 KDRVVWTIELNNRFIEAYNLL-GHQGATPCRILELMNDPRLTRFHIASHLQKYRTH 185
                          68*******************.9*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.29E-15129188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-22130188IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-18131185IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MPLAQFMTGK TLSSSFSPLS AFQIPRVVFP SVAEESCLWE ILFQALGGGV TVYRVKNVNL  60
DDIEDIWHHI FMYKQRKKLS AIDTDDNADE NSLHAAPPAP ADSTSTSAVR DSDPGRVKGS  120
SSRGAAGLAK KDRVVWTIEL NNRFIEAYNL LGHQGATPCR ILELMNDPRL TRFHIASHLQ  180
KYRTHLREMR EELHPRRSKF RYNFNDPNIC SGSHDGSVVR SVAMRSHQPP VDLAESFTKF  240
LSEMEDEELF ALAQSQNQLM IPHLSPASSR LSLGQDDIGS SDLDHARILA SDEFSNIFSM  300
LHKCVSGDTF SNSYVGLKIS NEGEFDTSRP AVSRSVSKPG ADKLEQHRCD WLSTRVFS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.13e-18response regulator 1